Protein Info for MIT1002_01652 in Alteromonas macleodii MIT1002

Annotation: Exodeoxyribonuclease III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 TIGR00195: exodeoxyribonuclease III" amino acids 1 to 266 (266 residues), 331.6 bits, see alignment E=3.7e-103 TIGR00633: exodeoxyribonuclease III (xth)" amino acids 1 to 267 (267 residues), 292.6 bits, see alignment E=2.7e-91 PF03372: Exo_endo_phos" amino acids 4 to 260 (257 residues), 111.9 bits, see alignment E=1.9e-36

Best Hits

Swiss-Prot: 62% identical to EX3_SALTI: Exodeoxyribonuclease III (xthA) from Salmonella typhi

KEGG orthology group: K01142, exodeoxyribonuclease III [EC: 3.1.11.2] (inferred from 94% identity to amc:MADE_02430)

MetaCyc: 62% identical to exodeoxyribonuclease III (Escherichia coli K-12 substr. MG1655)
3.1.4.-; 3.1.3.-; Deoxyribonuclease IV (phage-T(4)-induced). [EC: 3.1.21.2]; Exodeoxyribonuclease III. [EC: 3.1.21.2, 3.1.11.2]

Predicted SEED Role

"Exodeoxyribonuclease III (EC 3.1.11.2)" in subsystem DNA repair, bacterial (EC 3.1.11.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.11.2 or 3.1.21.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>MIT1002_01652 Exodeoxyribonuclease III (Alteromonas macleodii MIT1002)
MKVISFNINGIRARLHQLQAVIDAHQPDIIGLQEIKVHNEQFPVEAVEAMGYHVYFHGQK
SHYGVAFLAKKEPLSVSMGFPTDDEDAQRRMIILKTTDDAGEPVTVLNGYFPQGENEKHE
TKYPAKRKFYKDLMTYLDDNHTPDDNVIVMGDVNISHTDLDIGIGEDNRKRWLKTGKCSF
LPEEREWLNTVIDWGFEDSFRTLNPETNDKFSWFDYRSKGFNDNRGLRIDLILATKPLHA
KLHDAGIDYELRGIEKPSDHAPIWAEYKG