Protein Info for MIT1002_01641 in Alteromonas macleodii MIT1002

Annotation: Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 TIGR00011: Cys-tRNA(Pro) deacylase" amino acids 2 to 153 (152 residues), 167.6 bits, see alignment E=8.1e-54 PF04073: tRNA_edit" amino acids 32 to 143 (112 residues), 72.1 bits, see alignment E=2.1e-24

Best Hits

Swiss-Prot: 52% identical to YBAK_SHIFL: Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK (ybaK) from Shigella flexneri

KEGG orthology group: None (inferred from 96% identity to amc:MADE_02442)

MetaCyc: 52% identical to Cys-tRNAPro/Cys-tRNACys deacylase YbaK (Escherichia coli K-12 substr. MG1655)
3.1.1.M26 [EC: 3.1.1.M26]

Predicted SEED Role

"Cys-tRNA(Pro) deacylase YbaK"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.M26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (156 amino acids)

>MIT1002_01641 Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK (Alteromonas macleodii MIT1002)
MTPAITLLTKKRIAHSVLKYEHDANAASYGLEAVEKLNLNADTVFKTLVVSTDTNKLAVA
VVPVNTKLSEKKMAKALGVKKVEMAQANAVMVATGYVLGGVSPLGQKKRLASVIHKSAEG
LATMHVSAGKRGLEVALSPADLALLTSAKFADISIN