Protein Info for MIT1002_01625 in Alteromonas macleodii MIT1002

Annotation: Teichuronic acid biosynthesis protein TuaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 40 to 64 (25 residues), see Phobius details amino acids 76 to 100 (25 residues), see Phobius details amino acids 112 to 130 (19 residues), see Phobius details amino acids 144 to 162 (19 residues), see Phobius details amino acids 164 to 190 (27 residues), see Phobius details amino acids 284 to 309 (26 residues), see Phobius details amino acids 315 to 334 (20 residues), see Phobius details amino acids 353 to 371 (19 residues), see Phobius details amino acids 378 to 398 (21 residues), see Phobius details amino acids 410 to 432 (23 residues), see Phobius details amino acids 439 to 461 (23 residues), see Phobius details PF01943: Polysacc_synt" amino acids 7 to 270 (264 residues), 63.1 bits, see alignment E=3e-21 PF13440: Polysacc_synt_3" amino acids 29 to 318 (290 residues), 141 bits, see alignment E=4.8e-45

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (474 amino acids)

>MIT1002_01625 Teichuronic acid biosynthesis protein TuaB (Alteromonas macleodii MIT1002)
MSRLVSATSWTTLATLVNLVLTMVQLAFLVRILAPSVFGQFAVVNMVIEVFVAFALGGIS
NFLIFKRDADQQTSNAIYYLALIIGAIFSVLLYLLTPFIASALGYEAIIQELRLATLLLV
VSSLSSQYQAIGMKHFKHQSIAKIDIAAKLLSFSFAISFPELELLCLVGAIIIYQVAKLL
GFMLFLGKFVNLSLSTDTRIFKEAFNYGIFDFGSQAINIVRKQLDVMILAITLPSSEMGV
YHVIKQLASRPAQALQPIIGKVALPAFAEVKQNHEKFQRVYKDIYFLQLFVLAFIYVPVI
VASELVATLFFGDSYAQYSLVLSLLAGFWFIRVASSNLVGPLVQSTGHTKRNFLWNIYVM
IPNALVIYISSMFGVEALVFSMVVFQVTLFPIVNFYFVKYITGVEFSYSLRSMLIVVLAF
SIPIAVFHKFLVPLIPDLWFMQETSVAAFTVAVALVLYFQYSEVKNSIQRIKGF