Protein Info for MIT1002_01621 in Alteromonas macleodii MIT1002

Annotation: Lipid A core - O-antigen ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 6 to 21 (16 residues), see Phobius details amino acids 28 to 48 (21 residues), see Phobius details amino acids 54 to 79 (26 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 179 to 196 (18 residues), see Phobius details amino acids 207 to 237 (31 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details amino acids 277 to 294 (18 residues), see Phobius details amino acids 350 to 370 (21 residues), see Phobius details amino acids 379 to 399 (21 residues), see Phobius details amino acids 405 to 422 (18 residues), see Phobius details PF04932: Wzy_C" amino acids 208 to 361 (154 residues), 43 bits, see alignment E=2e-15

Best Hits

KEGG orthology group: None (inferred from 72% identity to alt:ambt_10615)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>MIT1002_01621 Lipid A core - O-antigen ligase (Alteromonas macleodii MIT1002)
MFEGLKVVVGLISFILVYRTVTGNCNKYLAFAICAIWLRFFLAAFHTITYPSLIAGFSIN
ALSSISVAGLGLFFLPFAVFTLRKLFPFYLFFIAIAVSGFVNMQIPGAINVLVKWCYFLV
LTGALFLSIRMQGQNETFRKLLVPFFMPVTLQILSILLGHAKAAEADGSTSFIGGYNHEA
AFSMIIVSFIFVIGLTKPNSIRFRTSLFSLSVILLILVNYRTSVLTILPIAAVFYFTLVE
QRLKPSQKVPVLSIVTMAIVLAFMVLSFTMRERFSDVGLLISNLDIIFKSPIYFSEAEKD
IMSARVFIWSQYIDAYNNAGALNQLIGFGPDSWKGVFAKYAHNTYVSNLYEYGVIGFSAF
IFMCAFCLQQAFNIANRGLSKIVAFSVIGFFIMNMATMPLWNIEGLIFFAILISVVFALA
TTKKSIHANKRDRNLNHEVRKVI