Protein Info for MIT1002_01612 in Alteromonas macleodii MIT1002

Annotation: Tyrosine-protein kinase ptk

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 738 transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 451 to 471 (21 residues), see Phobius details PF02706: Wzz" amino acids 17 to 108 (92 residues), 42 bits, see alignment E=2e-14 PF13807: GNVR" amino acids 400 to 470 (71 residues), 33.7 bits, see alignment E=5.7e-12 TIGR01007: capsular exopolysaccharide family" amino acids 522 to 719 (198 residues), 144.4 bits, see alignment E=1.7e-46 PF13614: AAA_31" amino acids 553 to 699 (147 residues), 40.8 bits, see alignment E=4.7e-14

Best Hits

KEGG orthology group: None (inferred from 92% identity to amc:MADE_02477)

Predicted SEED Role

"Capsular polysaccharide synthesis enzyme CpsD, exopolysaccharide synthesis"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (738 amino acids)

>MIT1002_01612 Tyrosine-protein kinase ptk (Alteromonas macleodii MIT1002)
MAVNGREEFNAGVFENETIDIAHYLGIIKRYAFRIVSLAIAFTILVALLVMRMTPMFTST
TTILVEAEKANVVSIEEVYGLDTKRKDYMQTQFEILQSRQIAERTVESLSLYNNEEFMPV
DEGPSLFDELKARIVEALPFLPQEEPKDLTEEQILAAKKRKATSLLMSALTVEMVDNTQV
MRITITTESPTLSAELANAVADVYIENYLQAKLDMTAKATSFLTDSLEGLKQKLTVAERN
LAKFYEKNQVVNIDGVVGLAADELEQLSKQLLDAQTALKLNAVIYRQTRNDVSLEDIARL
PEVLNHPTIRDVRRDEAKAMTRVSELSKVYGPKHPRMIAANAELSSIRETLSSQIRDLIT
SITTQYEVSEDRVAQLEQEVAQAKAEFRSLSALDNQRRALQREVDINQQLYNSFFTRLKE
TDELGGFESANARVLDAALPKYTPSEPNKKLLIGAAFVFSMGFGVFLAIAMETLNSGIRS
VEDVERKLGQRMLGLIPWLPHKKKTDLPIRSFFDGKKHQFAESVRTLRTSLSLLNLDKEQ
QAIMITSSVPKEGKTTVSINLAFALGQLDKTILIDADLRRPSVGKQFGIPNYQPGVANLI
LKSHTFDECLVQDEESKIDILSAGTIPSNPQELLADKGFGELIAQLKTQYKYVVVDTAPT
QAVSDSMVIANSCDSVIYVVRADSTSEKLINNGLSRFLQVGHRLDGVVLNQVDLRKSGAA
QRYAGFYDQYGYTSHKDS