Protein Info for MIT1002_01611 in Alteromonas macleodii MIT1002

Annotation: polysaccharide export protein Wza

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF02563: Poly_export" amino acids 30 to 103 (74 residues), 71.9 bits, see alignment E=4e-24 PF10531: SLBB" amino acids 109 to 156 (48 residues), 44.6 bits, see alignment E=1e-15

Best Hits

KEGG orthology group: K01991, polysaccharide export outer membrane protein (inferred from 96% identity to amc:MADE_02478)

Predicted SEED Role

"Capsular polysaccharide synthesis enzyme CpsC, polysaccharide export"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>MIT1002_01611 polysaccharide export protein Wza (Alteromonas macleodii MIT1002)
MKQHLMIKTVFLFLIFVTSSAFAQEGNLSMSQYQLGSGDRIKISVFGQDDLSMEVRLPDV
GTINYPFLGEIKLVGLTADEVEKKIYDGLLGDYLVNPSVSVAIVEYRPFFIDGEVKRPGG
YPYQPGLSVNKAAALAGGYTERAARDKITIIREKDGRTNEFTVTVSDMIQPGDIITINQR
FF