Protein Info for MIT1002_01608 in Alteromonas macleodii MIT1002

Annotation: UDP-glucose:undecaprenyl-phosphate glucose-1-phosphate transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 123 to 140 (18 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details amino acids 457 to 473 (17 residues), see Phobius details TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 34 to 479 (446 residues), 498 bits, see alignment E=3.4e-153 TIGR03023: undecaprenyl-phosphate glucose phosphotransferase" amino acids 36 to 479 (444 residues), 551 bits, see alignment E=3e-169 PF13727: CoA_binding_3" amino acids 77 to 253 (177 residues), 136.4 bits, see alignment E=1.1e-43 PF02397: Bac_transf" amino acids 289 to 471 (183 residues), 228.3 bits, see alignment E=4.9e-72

Best Hits

KEGG orthology group: K03606, putative colanic acid biosysnthesis UDP-glucose lipid carrier transferase (inferred from 96% identity to amc:MADE_02480)

Predicted SEED Role

"Capsular polysaccharide synthesis enzyme CpsA, sugar transferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (479 amino acids)

>MIT1002_01608 UDP-glucose:undecaprenyl-phosphate glucose-1-phosphate transferase (Alteromonas macleodii MIT1002)
MIIKALKAHPVESNTNGGLVVRNQSGFSTIYRLIDLSLVTILYYSAAAYYGTQIDTTSLI
LLFVNVICFQISAEGVELYRSWRGHRTPEMLRAAAITWTLSVLGTMSMGYFFVQEIKTPP
PAILLWFASSFVVLILWRFIMRKFLFRIRKSGLNTRRSIIIGATHLGANVALQIQQNEHL
GIRFNGIYDDREAERLPHEMQGAVLGNIEEAIEMAKRNEVDYIYIALPMSAENRIRAILE
QCSDTTANVYVIPNFFMYNLLNARWQTVGNVQALSVYDTPFQGASDVLKRFEDVVLSSLI
LMLISVPMLAIAAAVKLTSKGPVIFKQKRYGLDGKQITVYKFRSMTTQDNGAVVKQATKN
DARLTKIGGFLRRTSLDELPQFINVLQGRMSIVGPRPHAVAHNEEYRKIITGYMLRHKVK
PGITGWAQVNGLRGETETTNKMVQRVEYDLDYIHRWSIWFDIKIVFMTVFNGFINKNAY