Protein Info for MIT1002_01602 in Alteromonas macleodii MIT1002

Annotation: Fructosamine-3-kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 PF03881: Fructosamin_kin" amino acids 1 to 293 (293 residues), 316.6 bits, see alignment E=1.5e-98 PF01636: APH" amino acids 22 to 245 (224 residues), 40 bits, see alignment E=4e-14

Best Hits

KEGG orthology group: None (inferred from 89% identity to amc:MADE_02486)

Predicted SEED Role

"Ribulosamine/erythrulosamine 3-kinase potentially involved in protein deglycation"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>MIT1002_01602 Fructosamine-3-kinase (Alteromonas macleodii MIT1002)
MWHFISEHISDETQQFFSCHKAERVSGGDTHESYIIKDTTHRYFVKTRKYDDTQQLSHEA
EGLAAIANTQTIATPRVICHGITANETPNMEYLVLSHVRFIEPSENDYFILGQQLAAFHA
VNAYTSYGWPHDNYIGASVQTNGRMASWADFFAEKRIGSMLERLASIGTWKSEDGNIDDI
VTRVRHLLSLHQPHPSLLHGDLWAGNAGFNKKGPVLFDPAVYVGDAETDLAMAELFGGFP
QSFFEGYHQHTPIEKNYRLRKPIYQLYHILNHGLLFGAHYIAQAKQILDDIYKR