Protein Info for MIT1002_01579 in Alteromonas macleodii MIT1002

Annotation: putative adenine permease PurP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 196 to 214 (19 residues), see Phobius details amino acids 255 to 274 (20 residues), see Phobius details amino acids 295 to 313 (19 residues), see Phobius details amino acids 326 to 345 (20 residues), see Phobius details amino acids 351 to 369 (19 residues), see Phobius details amino acids 383 to 411 (29 residues), see Phobius details amino acids 423 to 440 (18 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 21 to 399 (379 residues), 168.2 bits, see alignment E=1.2e-53

Best Hits

KEGG orthology group: K06901, putative MFS transporter, AGZA family, xanthine/uracil permease (inferred from 98% identity to amc:MADE_02510)

Predicted SEED Role

"Xanthine/uracil/thiamine/ascorbate permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>MIT1002_01579 putative adenine permease PurP (Alteromonas macleodii MIT1002)
MSNNVIERLFKLQEHGTTVRTEIIAGLTTFAAMSYILVVNPGILGLSGMPVEGLITVTAI
AACMGTLMMALMTNYPIALAPGMGLNAFFAFTICLGREIPWEAALGIVFWNGILFLLLSL
TGVRTKIAESIPPSLKIGVQCGIGLFIAFIGLKNAGLIVDNPATFVQLGDLSEPAVMLAL
IGIIFTIVLMVKRVTGAILISIVTLTLIGAFIPTENGTLTATPSAVVGMPESISNTFMAM
DFWYPIDHLAETWDLIFALMFVNMFDTIGTLIGVSRKANLLTPEGKLPKIGSAMTADASA
SIAGALVGTSPVTSYVESATGVSAGGRTGLTAVVVSVCFLLSLFLTPLMKVIPLMATTPA
LLMVGILMMESIRQVDFDDLGALATASVALIAMPLTFSISEGIALGFITYVGIKVGTGKF
KEVTPLTYALAIVFLLRYLLDLK