Protein Info for MIT1002_01568 in Alteromonas macleodii MIT1002

Annotation: putative diguanylate cyclase YegE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 TIGR00229: PAS domain S-box protein" amino acids 2 to 122 (121 residues), 88.2 bits, see alignment E=4.7e-29 amino acids 148 to 251 (104 residues), 30.8 bits, see alignment E=2.8e-11 PF13188: PAS_8" amino acids 2 to 53 (52 residues), 19 bits, see alignment 3e-07 PF08448: PAS_4" amino acids 10 to 117 (108 residues), 32 bits, see alignment E=3.7e-11 PF00989: PAS" amino acids 10 to 112 (103 residues), 27.2 bits, see alignment E=1e-09 PF13426: PAS_9" amino acids 16 to 113 (98 residues), 47.6 bits, see alignment E=5.5e-16 amino acids 142 to 242 (101 residues), 11.7 bits, see alignment E=7.9e-05 PF08447: PAS_3" amino acids 23 to 109 (87 residues), 48.4 bits, see alignment E=2.8e-16 amino acids 154 to 237 (84 residues), 41.5 bits, see alignment E=3.9e-14 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 258 to 414 (157 residues), 125.5 bits, see alignment E=1.7e-40 PF00990: GGDEF" amino acids 263 to 413 (151 residues), 124.4 bits, see alignment E=1.2e-39

Best Hits

KEGG orthology group: None (inferred from 80% identity to amc:MADE_02522)

Predicted SEED Role

"diguanylate cyclase with PAS/PAC sensor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (425 amino acids)

>MIT1002_01568 putative diguanylate cyclase YegE (Alteromonas macleodii MIT1002)
MFEKTFHFCPVGLAHISVDGSFIRVNKRLCDFLGYSDEELTTLTFQELTAPDYLDEDLSY
LERLMAGDIDDYAIEKRYVRRDGEQVWAKLTVSLVRDQRGNPDYFISIVEDIDEKKRIQS
ELFQVDALFSKIVSAFSDRTFIWVATPDLSKLQYVNDGYSNIFGRSEYELYCNPMSFIDH
VHEDDKARVLKLFSQRPLQNWDIQYRINDSKGEVKYLHDRGSLIFDDREMQSLILGTADD
ITREKTQQQALLSAVTKLEHLSKTDSLTGLANRREIFSQLSDEISRMGRGQQTSTLVYID
LNKFKEINDKYGHNVGDKALVEFSERMSGLLRDSDRFGRIGGDEFVILLYGTNEKETEVF
FNRVAQSDFEVNVDGNKVVPIGFSAGWVEWSEGIETVQEWLDKADEVMYGKKRYQQVLTA
IDKAM