Protein Info for MIT1002_01564 in Alteromonas macleodii MIT1002

Annotation: General stress protein 14

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 PF03358: FMN_red" amino acids 14 to 127 (114 residues), 25.2 bits, see alignment E=1.1e-09 PF02525: Flavodoxin_2" amino acids 18 to 186 (169 residues), 157.2 bits, see alignment E=4.4e-50

Best Hits

Swiss-Prot: 41% identical to KEFG_SHIDS: Glutathione-regulated potassium-efflux system ancillary protein KefG (kefG) from Shigella dysenteriae serotype 1 (strain Sd197)

KEGG orthology group: K00358, [EC: 1.6.99.-] (inferred from 84% identity to amc:MADE_02527)

Predicted SEED Role

"Glutathione-regulated potassium-efflux system ancillary protein KefG" in subsystem Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (216 amino acids)

>MIT1002_01564 General stress protein 14 (Alteromonas macleodii MIT1002)
MTDENIIESNVESAKKSKKVLVLFAHPAQTRSEVNVPLFHEAKMNKHVTAVDLYAEYPDF
NIDIEREQQRLIDHDVVVFLFPLYWYSTPSILKEWQDLVLEYGFAYGHEGTALKDKLFLC
ALSAGGKEEAYQTDGFNHYTIRQLLQPLEQMAQITHMTYIAPFAIFGSRTAQEEHRVAEH
RGKWTTLLNKLTTNTLNLAKAKHIENLADLCTPQGD