Protein Info for MIT1002_01542 in Alteromonas macleodii MIT1002

Annotation: Glutamate-aspartate carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 40 to 65 (26 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 212 to 242 (31 residues), see Phobius details amino acids 263 to 281 (19 residues), see Phobius details amino acids 297 to 320 (24 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details amino acids 354 to 376 (23 residues), see Phobius details PF00375: SDF" amino acids 13 to 401 (389 residues), 400.4 bits, see alignment E=4.4e-124

Best Hits

KEGG orthology group: None (inferred from 93% identity to amc:MADE_02547)

Predicted SEED Role

"Proton/glutamate symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (419 amino acids)

>MIT1002_01542 Glutamate-aspartate carrier protein (Alteromonas macleodii MIT1002)
MSKKQSLLGNIGVQVVIAMIIGTAVGAFMGESAEMFAPLGAIFINLIKMLVIPLVAVALI
SGAAGLGNSTNAGKVGLSTLAYFALTSALAVTLALIMGEVFKPGIGIDVSAVEGMFSGEY
ASKGELPSFWATVTGMIPTNVFASLTNANILQILVFCLFFGLALSKQPKKNREPILNGVN
TIVDAMVWMINCVMKIAPIGVFGLMAEAVGTFGFAALMVVFKLFLVFTAAILVFGFVVYP
LLVQLFTRTSAKSFLVAMKKPQAVALSTASSMATLPVTMNTVENELGVRNATASFVLPLG
ATINMSGNAIYYGLVAVFFAQLFNIDLSMGAYVAIILTSTLGAVGQAGVPGPSFLVVAVL
LAAGIPIEGLPLLFALDRIFDMIRTALNITGDAACAVIVDTIAIDANAIEEQPIENTAK