Protein Info for MIT1002_01538 in Alteromonas macleodii MIT1002

Annotation: Succinylglutamate desuccinylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 TIGR03242: succinylglutamate desuccinylase" amino acids 35 to 333 (299 residues), 348.8 bits, see alignment E=1.6e-108 PF24827: AstE_AspA_cat" amino acids 54 to 249 (196 residues), 175.3 bits, see alignment E=1.1e-55 PF04952: AstE_AspA_hybrid" amino acids 262 to 335 (74 residues), 87.1 bits, see alignment E=6.3e-29

Best Hits

Swiss-Prot: 52% identical to ASTE_PSEHT: Succinylglutamate desuccinylase (astE) from Pseudoalteromonas haloplanktis (strain TAC 125)

KEGG orthology group: K05526, succinylglutamate desuccinylase [EC: 3.5.1.96] (inferred from 86% identity to amc:MADE_02550)

Predicted SEED Role

"Succinylglutamate desuccinylase (EC 3.5.1.96)" in subsystem Arginine and Ornithine Degradation (EC 3.5.1.96)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.96

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>MIT1002_01538 Succinylglutamate desuccinylase (Alteromonas macleodii MIT1002)
MQELIESGQFLTLSRRNSALFERSHQFTLANGTLVDITAPGIISFSVQPTSKPNKRIVLS
CGVHGNETAPIEICDDLVKGILTGNITLAHDVLFLFGNLPAMDIAERFVEENMNRLFSGA
HSKGEGLVNAERVRAKQLEDAVASFFKAGEGTRYHYDLHTAIRASKNEKFAVYPYLHDRI
HSKGQLAFLAACGVKTILLSESSTTTFSYFSSYQYNAHAFTVELGKVRPFGQNDMRRFED
AKQAITQLITQTEYAPTVDMNELDIYRVNQVINRNEEQFTLHFDDDTPNFTDYPKGTVLA
SETGKEYVAEQDGEAIVFPNAKVAIGQRALLTVVPTTLEKLDV