Protein Info for MIT1002_01529 in Alteromonas macleodii MIT1002

Annotation: Formate channel 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 transmembrane" amino acids 32 to 89 (58 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 160 to 184 (25 residues), see Phobius details amino acids 195 to 221 (27 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details PF01226: Form_Nir_trans" amino acids 8 to 257 (250 residues), 215 bits, see alignment E=5.3e-68

Best Hits

KEGG orthology group: None (inferred from 98% identity to amc:MADE_02558)

Predicted SEED Role

"Nitrite transporter from formate/nitrite family" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (282 amino acids)

>MIT1002_01529 Formate channel 1 (Alteromonas macleodii MIT1002)
MAYLLPAEFATKMVDAGEAKIYMSTRDTLIRAYMAGAILALAAVFAVTIAVQTGVFLLGA
VLFPVGFCMLYLMGFDLLTGVFVLTPLAWLAQRPGVTPKQILRNWGLVFLGNFGGALTVA
FMMSFIFTMGYNVDGGAIATKVASIGEARTLGYAEHGVAGWFTIFIRGMLCNWMVSLGVV
GAMISTHVSGKVLAMWMPIMLFFFMGFEHSVVNMFLFPFGLIMGGDFSVMDYFIWNEIPT
ALGNLVGGLAFTGLTLYTTHVKTLPKRTIPVDKAAASQTLPI