Protein Info for MIT1002_01494 in Alteromonas macleodii MIT1002

Annotation: Amino-acid carrier protein AlsT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 80 to 108 (29 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 209 to 230 (22 residues), see Phobius details amino acids 299 to 321 (23 residues), see Phobius details amino acids 349 to 368 (20 residues), see Phobius details amino acids 387 to 407 (21 residues), see Phobius details amino acids 413 to 434 (22 residues), see Phobius details TIGR00835: amino acid carrier protein" amino acids 20 to 439 (420 residues), 468.1 bits, see alignment E=1.3e-144 PF01235: Na_Ala_symp" amino acids 52 to 447 (396 residues), 502.5 bits, see alignment E=5.8e-155

Best Hits

Swiss-Prot: 46% identical to GLNT_BACSU: Probable sodium/glutamine symporter GlnT (glnT) from Bacillus subtilis (strain 168)

KEGG orthology group: K03310, alanine or glycine:cation symporter, AGCS family (inferred from 98% identity to amc:MADE_02218)

Predicted SEED Role

"Sodium/alanine symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (468 amino acids)

>MIT1002_01494 Amino-acid carrier protein AlsT (Alteromonas macleodii MIT1002)
MINEFVSLVNNILWGDGQVLIIMLLACGIWFTVKLGGVQLRHFGHMFSLLKGSNTSTKDG
ISSFQALCTSLSARVGTGNLAGVAVAISLGGAGAIFWMWMIALLGMATGFAESVLGQLYK
VRDENGEFRGGPAYYIKQGLNKTWLAVAFSLCLFFGYGFVFSAVQANTITDALNNAYSFP
TEYVGLAIIALAALIVVGGLKSIARFAEFVVPFMGIGYVLVALAITFINISELPAMLLDI
VKSAFGLQEAGAGALGAAIKNGIQRGLYSNEAGSGSVPHAAASAVPNPNHPVSQGYIQML
GVFLDTLVLCTSTAFIILLAGGSSSDQMEGIRLTQDAMSSHLGEGGTDFVAAAISLFAFT
SVVANYAYGESNLHMFKLDNKIGRAVYTIGYLGMIYWGAQAALPQVWAMADMALGLMTVI
NIIAIVWMTPTIVSISKDYFKKKDSGANMEYKAGDCEIQGKSEDGIWD