Protein Info for MIT1002_01479 in Alteromonas macleodii MIT1002

Annotation: PhoH-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 PF02562: PhoH" amino acids 117 to 320 (204 residues), 328.5 bits, see alignment E=2.2e-102 PF13604: AAA_30" amino acids 121 to 273 (153 residues), 31.5 bits, see alignment E=2.2e-11 PF13245: AAA_19" amino acids 124 to 273 (150 residues), 30.9 bits, see alignment E=4.3e-11

Best Hits

Swiss-Prot: 75% identical to PHOL_ECOL6: PhoH-like protein (ybeZ) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K06217, phosphate starvation-inducible protein PhoH and related proteins (inferred from 96% identity to amc:MADE_02231)

Predicted SEED Role

"Phosphate starvation-inducible protein PhoH, predicted ATPase" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>MIT1002_01479 PhoH-like protein (Alteromonas macleodii MIT1002)
MSTLVSNEFELEPADSKRLSSLCGPFDDNIKQIERRLGVEITYRNNAFKVLGEPQQIKSA
SELLKLLYIETQPIKGRIPELEAEQVHLAIQEARVIEKDATGGYGKEVNIKTKRGVIKPR
NPNQAQYVANIVNHDITFGIGPAGTGKTYLAVAAAVDALERQEIRRILLTRPAVEAGEKL
GFLPGDLSQKVDPYLRPLYDALFEMLGFEKVEKLMERNVIEVAPLAYMRGRTLNDAFIIL
DESQNTTVEQMKMFLTRIGFNSKAVITGDITQVDLPRGAKSGLRHAIEVLSEVDDISFNF
FNAEDVVRHPVVARIVRAYEVHDAEQERLRKARKEEALRLQREQASQDDNATQTKDDNAS