Protein Info for MIT1002_01478 in Alteromonas macleodii MIT1002

Annotation: Endoribonuclease YbeY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 PF02130: YbeY" amino acids 29 to 149 (121 residues), 140.3 bits, see alignment E=2.2e-45 TIGR00043: rRNA maturation RNase YbeY" amino acids 44 to 149 (106 residues), 127.3 bits, see alignment E=1.4e-41

Best Hits

Swiss-Prot: 88% identical to YBEY_ALTMD: Endoribonuclease YbeY (ybeY) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K07042, probable rRNA maturation factor (inferred from 88% identity to amc:MADE_02232)

Predicted SEED Role

"Metal-dependent hydrolase YbeY, involved in rRNA and/or ribosome maturation and assembly"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (158 amino acids)

>MIT1002_01478 Endoribonuclease YbeY (Alteromonas macleodii MIT1002)
MSAIIDVQQAFEGDEAILSAIPSPSELELWANAVLKYEGLTEQEVTIRFTDEAESQSLNH
EYRGKDKPTNVLSFPFEAPPGIEINLLGDLVICAPVISREAEEQHKDVSNHYAHMTVHGL
LHLMGYDHIDDAEAEEMESKEIDILAHLGIANPYESID