Protein Info for MIT1002_01472 in Alteromonas macleodii MIT1002

Annotation: 16 kDa heat shock protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 PF00011: HSP20" amino acids 44 to 142 (99 residues), 78.4 bits, see alignment E=2e-26

Best Hits

Swiss-Prot: 49% identical to IBPA_SERP5: Small heat shock protein IbpA (ibpA) from Serratia proteamaculans (strain 568)

KEGG orthology group: K04080, molecular chaperone IbpA (inferred from 94% identity to amc:MADE_02239)

Predicted SEED Role

"16 kDa heat shock protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (149 amino acids)

>MIT1002_01472 16 kDa heat shock protein A (Alteromonas macleodii MIT1002)
MRTIDLSPLYRSFIGSDHLASLVDAASRAEKQSTYPPYNIELLGDDKYRVTMAIAGFSKD
DVSIQVEENTLTITGTKKTEADDKESKERKFLHKGISERNFERKFQLGDHVKVLAADMEN
GLLHIDMERVIPEAKKPRQIEIGSRLIEN