Protein Info for MIT1002_01445 in Alteromonas macleodii MIT1002

Annotation: putative inorganic polyphosphate/ATP-NAD kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 PF01513: NAD_kinase" amino acids 6 to 118 (113 residues), 73.7 bits, see alignment E=1.9e-24 PF20143: NAD_kinase_C" amino acids 145 to 270 (126 residues), 140.3 bits, see alignment E=2.9e-45

Best Hits

Swiss-Prot: 63% identical to NADK_AERS4: NAD kinase (nadK) from Aeromonas salmonicida (strain A449)

KEGG orthology group: K00858, NAD+ kinase [EC: 2.7.1.23] (inferred from 97% identity to amc:MADE_02268)

MetaCyc: 55% identical to NAD kinase (Escherichia coli K-12 substr. MG1655)
2.7.1.M29,2.7.1.23 [EC: 2.7.1.23, 2.7.1.M29]

Predicted SEED Role

"NAD kinase (EC 2.7.1.23)" in subsystem NAD and NADP cofactor biosynthesis global (EC 2.7.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.23

Use Curated BLAST to search for 2.7.1.23 or 2.7.1.M29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>MIT1002_01445 putative inorganic polyphosphate/ATP-NAD kinase (Alteromonas macleodii MIT1002)
MPYQTVALIGKPQHAATHDSLNILAEYLLAKGCKLLVEESIAEELETENFKSCNLVTIGK
EADLAVVVGGDGSMLGAARVLARFDIHVVGVNRGNLGFLTDIHPDDIVQQLDLIFNGECV
VEERFLLEVEVYRHEKLKSNNSAVNEVVLHHGKVAHMMEFEIYIDEQFVFSQRSDGLIVA
TPTGSTAYSLSAGGPIIMPKLDALTLVPMFPHTLSSRPIVVDADSQVSMKVSKVNSDSLQ
VSCDSHIVLPVLPGDEIRINKSVDKLHLVHPKGYSYFNVLRKKLGWGSKLY