Protein Info for MIT1002_01429 in Alteromonas macleodii MIT1002

Annotation: Anthranilate synthase component II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 TIGR00566: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase" amino acids 8 to 198 (191 residues), 169.4 bits, see alignment E=3.9e-54 PF00117: GATase" amino acids 10 to 198 (189 residues), 164.8 bits, see alignment E=1.9e-52 PF07722: Peptidase_C26" amino acids 84 to 184 (101 residues), 36.9 bits, see alignment E=3.6e-13

Best Hits

Swiss-Prot: 58% identical to TRPG_SERMA: Anthranilate synthase component 2 (trpG) from Serratia marcescens

KEGG orthology group: K01658, anthranilate synthase component II [EC: 4.1.3.27] (inferred from 93% identity to amc:MADE_02289)

Predicted SEED Role

"Anthranilate synthase, amidotransferase component (EC 4.1.3.27)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Tryptophan synthesis (EC 4.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.27

Use Curated BLAST to search for 4.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (210 amino acids)

>MIT1002_01429 Anthranilate synthase component II (Alteromonas macleodii MIT1002)
MNQQVTTLFLLDNVDSFTYNLVDELRTLNLDIIVYRNTVSANALFERMQEQATKGPVLLM
LSPGPGAPSEAGCMPELLKKVHGVFPVIGICLGHQAIVEHYGGTVGRASQVMHGKSSAIT
HSEDAMFKGLQQPLHVARYHSLVAHSLPENLTVCASTINDDGSEAVMAVYNSEDRMLGFQ
FHPESILTAHGSLLLKQSIDYLTLQGANHA