Protein Info for MIT1002_01419 in Alteromonas macleodii MIT1002

Annotation: Transport of quorum-sensing signal protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 53 (20 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 139 to 162 (24 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details amino acids 222 to 253 (32 residues), see Phobius details amino acids 258 to 277 (20 residues), see Phobius details amino acids 293 to 319 (27 residues), see Phobius details PF01594: AI-2E_transport" amino acids 16 to 325 (310 residues), 215.8 bits, see alignment E=5.1e-68

Best Hits

Swiss-Prot: 43% identical to Y338_HAEIN: Putative transport protein HI_0338 (HI_0338) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 95% identity to amc:MADE_02299)

MetaCyc: 42% identical to autoinducer 2 exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-453

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (346 amino acids)

>MIT1002_01419 Transport of quorum-sensing signal protein (Alteromonas macleodii MIT1002)
MSMELRSPTAKILIVLACLVVVMAGIKAASTIMVPFFLSIFIAIACSPIIRWTSKFGVPK
WLSITFVILLIVVFGFLLAGLVGQSMTEFRENLPEYRSKLDTEFAWVVSKLAEFNIHINR
ELIASHLDPATAMSVATNFISGMGGVLSNLFLILLTVIFMLFEADSIPRRLHIALADPGM
KLKHIDRFIRSVNSYLAIKTVVSLGTGLIIGVWLYVMGVDHFMLWAVLAFMLNFIPNIGS
IIAAVPAVLIAFVQLGPASAGFAALGFVLVNTIMGNMVEPRLMGKGMGLSTLVVFLSLIF
WGWLLGTVGMLLSVPLTMVVKIALESREESKWLAVLLSSEGEKSVS