Protein Info for MIT1002_01379 in Alteromonas macleodii MIT1002

Annotation: Biotin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 TIGR00433: biotin synthase" amino acids 26 to 321 (296 residues), 416.6 bits, see alignment E=2.7e-129 PF04055: Radical_SAM" amino acids 60 to 216 (157 residues), 83.4 bits, see alignment E=2.2e-27 PF06968: BATS" amino acids 231 to 321 (91 residues), 103.7 bits, see alignment E=4.8e-34

Best Hits

Swiss-Prot: 97% identical to BIOB_ALTMD: Biotin synthase (bioB) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K01012, biotin synthetase [EC: 2.8.1.6] (inferred from 97% identity to amc:MADE_02211)

MetaCyc: 70% identical to biotin synthase (Escherichia coli K-12 substr. MG1655)
Biotin synthase. [EC: 2.8.1.6]

Predicted SEED Role

"Biotin synthase (EC 2.8.1.6)" in subsystem Biotin biosynthesis (EC 2.8.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (374 amino acids)

>MIT1002_01379 Biotin synthase (Alteromonas macleodii MIT1002)
MTLASAPSAQTTTIRNDWTKAEVEALFAMPFNDLLFNAQVVHRQHFNPNEVQVSTLLSIK
TGACPEDCKYCPQSARYDTGLEKERLLEIEKVIQRAKEAKQVGSTRFCMGAAWRNPRDRD
MPYILKMVEEVKSLGLETCMTLGMLTRDQAVALKQAGLDYYNHNLDTSPEYYGDIITTRT
YQDRLNTLENVRAAGMNVCSGGIVGMGETVSDRASMLVQLANLPEQPQSVPINMLVKVKG
TPLDSVEDLDYFEFIRTIAVARIMMPKSHVRLSAGREAMNEQMQALCFMAGANSIFYGCK
LLTTSNPDTHEDVMLFKKLGINTERTRDYSDEAHQQVLEEEIAQQQEQGDDSNDLFIDAT
KPKVAPKKQHLTEA