Protein Info for MIT1002_01369 in Alteromonas macleodii MIT1002

Annotation: Paraquat-inducible protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 84 to 104 (21 residues), see Phobius details amino acids 130 to 156 (27 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 205 to 226 (22 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details amino acids 306 to 332 (27 residues), see Phobius details amino acids 353 to 372 (20 residues), see Phobius details amino acids 383 to 402 (20 residues), see Phobius details PF04403: PqiA" amino acids 83 to 230 (148 residues), 120.4 bits, see alignment E=3.5e-39 amino acids 255 to 411 (157 residues), 192.1 bits, see alignment E=2.8e-61

Best Hits

KEGG orthology group: K03808, paraquat-inducible protein A (inferred from 94% identity to amc:MADE_02655)

Predicted SEED Role

"Paraquat-inducible protein A" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (415 amino acids)

>MIT1002_01369 Paraquat-inducible protein A (Alteromonas macleodii MIT1002)
MPTISYAVDSKNQRVIPLGCYLSYNEHTKSGVQKHMAESNTLSIVCEQCHTQVHIPALAH
RQRAVCPVCNHTLISHRDGASEKLLAYTFSALIFLLLSLPFNFLTFKASGQKHSIDLPTG
ITVLIENDYLSLAIITSLATLLLPGMVLGGLLILSLAQIQNRRPFYLPRLYKLVKALLPW
SMAEIFLVGTLVSLIKITELADVSIGLSFYAFVGFSAFTALCISQFDPTRYAMWMSQGQP
PQPKPLCEAQARESIQRTWALLITACILYIPANVLPIMYTEFFGQETPNTIIGGVISLWE
SGSYPVAIIILVASVVVPVAKIIILAWLNFSVQREKTTSKQLRIRYYRITEAIGRWSMID
VFVVAVLVSLIQMGNTMSIYPGQAALAFCAVVFVTMIAAMTFDSRLIWQQWKQLP