Protein Info for MIT1002_01350 in Alteromonas macleodii MIT1002

Annotation: Autoinducer 2 sensor kinase/phosphatase LuxQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 825 transmembrane" amino acids 410 to 433 (24 residues), see Phobius details PF13424: TPR_12" amino acids 171 to 234 (64 residues), 33.4 bits, see alignment 1.7e-11 PF13176: TPR_7" amino acids 208 to 233 (26 residues), 19 bits, see alignment (E = 4.6e-07) PF00512: HisKA" amino acids 457 to 521 (65 residues), 70.6 bits, see alignment 3.8e-23 PF02518: HATPase_c" amino acids 569 to 680 (112 residues), 84.5 bits, see alignment E=2.9e-27 PF00072: Response_reg" amino acids 707 to 816 (110 residues), 81.9 bits, see alignment E=1.5e-26

Best Hits

KEGG orthology group: None (inferred from 74% identity to amc:MADE_02676)

Predicted SEED Role

"multi-sensor hybrid histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (825 amino acids)

>MIT1002_01350 Autoinducer 2 sensor kinase/phosphatase LuxQ (Alteromonas macleodii MIT1002)
MGTVSAHASISDKVSEIKVDVETLVPMPIGAAIKKLEAWLLSDTLTQDEKRKVGALYVQY
QLSIHQRPSEKILNSLIALQDNSSEGLTIATGVARMYGISADYDKAYEHFNRVVATPDIP
PSVKAYALIYQVLTYSEGQVFTPSAELINTVNDILTKHTLTKLRPLYYAIVADYYQSVSA
YDIALSYYEKSLDGAKVENQRILVSDNLYAIGILYRNLGNYSKAIDYFERTIEFDSQIDI
NYSEFLATYGIATTYYRSGNLQKALTLSDIVLAHPLSSSFYNSEIYRLKAEAHLSLGELD
KATNALNKARVLYDENREAEQTTWRAQLDKTEAYITAAKGDHALAFKQFEVFHEAYLNAK
KYEDLELIKSANLIDQITQEKDRANQLENENKAFEEALLLKTEAQRTQSLFSTLLVILIT
LTLVTIVIILILLSKSRQANALYLTAKEKAELNNRLKSEFISNISHEIRTPLNAIIGFGQ
SLASRAADVQAKDLTKKIVNASEMLLQLINDLLDFSKIEAGKLTLAIRPHDINESLCTLV
DIFSDQAKRKGLVLQLHIDKNLNNDLMFDELRFKQILANLISNAIKFSDKGIIEIGLSVS
ESNDSHCALHCWVKDNGIGISKENQVKLFTPFTQAESSIARKYGGTGLGLNISNNLLKLM
GSSLALESELERGSTFSFDVTFAVAADIDAPLSETTQQHVTLEGARVLLAEDNDINVEVI
KALLDEFHLDLTHVSNGQKAIDALKACTYDLVLMDIQMPEVDGLSATRHIRNVLKLKTPI
IALTANAMQQDIDNCHAAGMDAHVGKPVDKARLVNTLGEFLAHSA