Protein Info for MIT1002_01338 in Alteromonas macleodii MIT1002

Annotation: translocation protein TolB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 14 to 447 (434 residues), 523.6 bits, see alignment E=1.9e-161 PF04052: TolB_N" amino acids 23 to 125 (103 residues), 107.9 bits, see alignment E=5.6e-35 PF07676: PD40" amino acids 213 to 248 (36 residues), 36.2 bits, see alignment 8.8e-13 amino acids 256 to 292 (37 residues), 39.7 bits, see alignment 6.8e-14 amino acids 300 to 335 (36 residues), 42.7 bits, see alignment 8e-15 amino acids 389 to 412 (24 residues), 12.9 bits, see alignment (E = 1.8e-05)

Best Hits

Swiss-Prot: 68% identical to TOLB_PSEA6: Tol-Pal system protein TolB (tolB) from Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

KEGG orthology group: K03641, TolB protein (inferred from 97% identity to amc:MADE_02684)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (451 amino acids)

>MIT1002_01338 translocation protein TolB (Alteromonas macleodii MIT1002)
MKKLGLWIALITMAFSAKVFASLEIVITEGVDSARPIGVVPFKWKGQGSMPGDISKVVMA
DLMRSGKFNPVSVDKMPQYPETAEQVSFTAWATLGVDTVLVGSIEPQGGDRYLVSYELID
VLKGQVDNGQAKVLKDGNLVSSNDHVLAARQAVINGRDFRQYAHRISDIVYEKLTGVRGA
FLTKIAYVIVRDRDTVEKPYQLVIADYDGENETRLLSSPEPLMSPVWSPDGEKLAYVSFE
NRRPQIFIQNIYTSERTRITDFPGINSSPVFSPDGKQLAMVLSKDGNPELYVMDLATKNL
RRVTRNRAIDTEPAWLPDGSGLIFSSERGGKPQIYSVNLNSGKVRRVTFVGEQNLGGTIS
PDGKQMIMVNQTNGNYHIAKQSLDGGSPQVLTRTYLDESPSVAPNGSMIIYSTLHEGTQV
LSLVSLDGRFKARLPAANGQVKSPSWSPFLF