Protein Info for MIT1002_01322 in Alteromonas macleodii MIT1002

Annotation: Cyclic di-GMP phosphodiesterase Gmr

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 690 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 257 to 418 (162 residues), 129.8 bits, see alignment E=4.1e-42 PF00990: GGDEF" amino acids 259 to 415 (157 residues), 151.2 bits, see alignment E=2.3e-48 PF00563: EAL" amino acids 438 to 670 (233 residues), 228 bits, see alignment E=1.1e-71

Best Hits

KEGG orthology group: None (inferred from 82% identity to amc:MADE_01719)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (690 amino acids)

>MIT1002_01322 Cyclic di-GMP phosphodiesterase Gmr (Alteromonas macleodii MIT1002)
MFRTLKIPIGLVIALTMSVLALSVVIVNKLERNASVVDVVKGNTATLSNALSLQLLVVME
RSPGDNALFSSLFQPIKEHDNLISATLYDNDYQVISTIQPDSLSQLSNQSVPLDPAEIPF
GVTQYDNVITAHQIVGSSLYPLGHVVLYVDIEDTMAASSARQLIKQVPIVIAVWLLCTGT
CVFILYRLISPIGSLRQFTQEVFESKDYALRSSLNTSNEIGQLSNNINSLLDTIEVELFI
NFEQKQTLVDQQETMSRLANFDSLTGLPNRQFVLDNLRLELARAKRNDEDLLLLFFDLDG
FKGINDSLGHETGDLILIEVADRVQCLLRDGDLFARLGGDEFLVLPDRDVTTDQAQSLAT
RLITAFDEPFELRGLSLTVGLSVGIATASDAGYDLSELMSNADLAMYRSKARGRGSYTLF
TPDMVESHKRKLHLANGIEQGISNDEFVVYYQVKVNNEGNVIGVEALIRWQHPEFGLVMP
NEFIPIAEQGGKITAITRWVIKRVCIDMPDLKQWATSPFRASINLSGHDLRSSQLFDYIY
NTFKLYDINPENIEFEVTESAYLENFTLSNKFFRRIGNMGCAIALDDFGTGYSSLSYLTQ
INIDTLKVDRQFVMEIQTSERSRLVTGAIIDLAKRLSLSVCAEGIENLEQWNYLREHGCD
NVQGFMFSKPIPLSELTCSPSHYSDSSFSV