Protein Info for MIT1002_01313 in Alteromonas macleodii MIT1002

Annotation: Carnitinyl-CoA dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 transmembrane" amino acids 94 to 114 (21 residues), see Phobius details PF00378: ECH_1" amino acids 11 to 217 (207 residues), 90.6 bits, see alignment E=1e-29 PF16113: ECH_2" amino acids 28 to 172 (145 residues), 45.7 bits, see alignment E=6.8e-16

Best Hits

KEGG orthology group: None (inferred from 90% identity to amc:MADE_01710)

Predicted SEED Role

"Enoyl-CoA hydratase (EC 4.2.1.17)" in subsystem Acetyl-CoA fermentation to Butyrate or Butanol Biosynthesis or Isoleucine degradation or Polyhydroxybutyrate metabolism or Valine degradation or n-Phenylalkanoic acid degradation (EC 4.2.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (238 amino acids)

>MIT1002_01313 Carnitinyl-CoA dehydratase (Alteromonas macleodii MIT1002)
MQNLALTYTGDVAILTMQNGENRHNPLFAKEMLSALNTIKSNESCKALVITSNDEKCFSL
GIDTDWLMPAMKAARTEEIKQFMYGMDDVFKALLLFPLPVIAAINGHAFGNGAILACACD
FRFMRADKGFFCFPEVDLSIPFLPGMIEFVKKAMPYYRFNEMKLSGRRVSGKELEQDHVV
EKAYDTQESLMEGALNYAKTFDKKRGIFGEHKKRLHKHIIHTIDNENKPLIESLSLMA