Protein Info for MIT1002_01305 in Alteromonas macleodii MIT1002

Annotation: Putative multidrug export ATP-binding/permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 602 transmembrane" amino acids 28 to 48 (21 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 137 to 161 (25 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details amino acids 287 to 306 (20 residues), see Phobius details PF00664: ABC_membrane" amino acids 31 to 293 (263 residues), 181.9 bits, see alignment E=2.1e-57 PF00005: ABC_tran" amino acids 381 to 529 (149 residues), 117.3 bits, see alignment E=8.2e-38

Best Hits

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (602 amino acids)

>MIT1002_01305 Putative multidrug export ATP-binding/permease protein (Alteromonas macleodii MIT1002)
MTTPLASVSTKQVLQWIGSHLLRYKARVVGAVIALFTAAVAWLLLGQGIKYAIDSGFIEN
AADTLNKATVLVLAITIVACLATYARFYLMTWLGERVSADIRNQVYAHLLSLPPSFFAEL
RTGEVISRFTSDTTIIQTVVGMSLSMTLRSVVTFVGALALMTFSSPLLTFCVIVAVPAVL
VPIKVLAPQVRRYAKESQDKVADLGARIDESLHEIMTVQAYTAENAERLHFSKKVELAMD
VAKKRIHYRSLLIGCIMCISMTAIIFIAWVGARQVLDSTMTVGELSAFLFYAVMAGGSVA
TISEVIGEVQRGVGASERLYELFTTKPSIRSLNGDTAEASASSTYSALKGASAKPIISKA
APKIELENVSFAYPNSKPLFDNLNINIQAGERLALVGASGAGKTTLFQLLMRFYDPSAGQ
ILFNGAPINKMPVDVLRQHIAIVTQEPVVFADTVLENIRYGSPHASDDAVINAAKQAFAH
EFIDNLDERYNTQLGERGVKLSGGQKQRIAIARAILADRPILLLDEATSALDAMSERMVQ
QAIDRLMVGKTSIVIAHRLATVQHADRILVMDKGQVVGSGDHASLMKSDTLYREYAELQL
LS