Protein Info for MIT1002_01278 in Alteromonas macleodii MIT1002

Annotation: RNA polymerase sigma factor SigV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 24 to 173 (150 residues), 75.2 bits, see alignment E=2.3e-25 PF04542: Sigma70_r2" amino acids 26 to 92 (67 residues), 55.4 bits, see alignment E=6.3e-19 PF07638: Sigma70_ECF" amino acids 81 to 174 (94 residues), 22.1 bits, see alignment E=1.9e-08 PF08281: Sigma70_r4_2" amino acids 117 to 169 (53 residues), 50.2 bits, see alignment E=2.5e-17

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 97% identity to amc:MADE_02709)

Predicted SEED Role

"RNA polymerase sigma-70 factor, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (185 amino acids)

>MIT1002_01278 RNA polymerase sigma factor SigV (Alteromonas macleodii MIT1002)
MFGRNKSDNAQVLSGMKAKHQRYEALVKAFHADIYRYAFWLIKDQSIAEDVVQETFLRAW
RSLDALNDEKAAKSWLITILRRENARRFERKQFDTVDIDDCHIQDDTQHADGDLKDRELQ
RLLGGLSVEYREPLILQLIFGFSGEEIANQLGLNKNTVMTRLFRARNQLKEALEKQNEQR
GRVNG