Protein Info for MIT1002_01252 in Alteromonas macleodii MIT1002

Annotation: Electron transport complex protein RnfE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 transmembrane" amino acids 20 to 50 (31 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details PF02508: Rnf-Nqr" amino acids 7 to 200 (194 residues), 220.9 bits, see alignment E=6.2e-70 TIGR01948: electron transport complex, RnfABCDGE type, E subunit" amino acids 9 to 208 (200 residues), 281.3 bits, see alignment E=1.8e-88

Best Hits

Swiss-Prot: 73% identical to RNFE_PSEA6: Ion-translocating oxidoreductase complex subunit E (rnfE) from Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

KEGG orthology group: K03613, electron transport complex protein RnfE (inferred from 94% identity to amc:MADE_02734)

Predicted SEED Role

"Electron transport complex protein RnfE" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (230 amino acids)

>MIT1002_01252 Electron transport complex protein RnfE (Alteromonas macleodii MIT1002)
MTDFHDLSLQGLWKNNPALVQLLGLCPLLAVTATFINGLGLGLATMLVLIGSNVTVSLVR
NVVRNEIRIPVFVMIIAAFVTIVQLLMNAYTYDLYLALGIFIPLIVTNCAIIGRAEAFAS
KNGPLASAYDGFMMGLGFTAVLVILGGMREILGAGTLLAGADRLFGSIAENWTITLFNTE
NPFLLAILPPGAFLGMGLLIAIKNSIDAKLAAKQTSPAVKAERVRVTAES