Protein Info for MIT1002_01242 in Alteromonas macleodii MIT1002

Annotation: Ribonuclease T

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 TIGR01298: ribonuclease T" amino acids 8 to 206 (199 residues), 322.8 bits, see alignment E=4.3e-101 PF00929: RNase_T" amino acids 18 to 192 (175 residues), 98.5 bits, see alignment E=6.4e-32 PF16473: Rv2179c-like" amino acids 18 to 191 (174 residues), 29.2 bits, see alignment E=7.4e-11

Best Hits

Swiss-Prot: 69% identical to RNT_VIBPA: Ribonuclease T (rnt) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K03683, ribonuclease T [EC: 3.1.13.-] (inferred from 98% identity to amc:MADE_02742)

MetaCyc: 62% identical to ribonuclease T (Escherichia coli K-12 substr. MG1655)
Ribonuclease D. [EC: 3.1.13.5]; 3.1.13.5 [EC: 3.1.13.5]; 3.1.13.- [EC: 3.1.13.5]

Predicted SEED Role

"Ribonuclease T (EC 3.1.13.-)" in subsystem tRNA processing (EC 3.1.13.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.1.13.5

Use Curated BLAST to search for 3.1.13.- or 3.1.13.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (211 amino acids)

>MIT1002_01242 Ribonuclease T (Alteromonas macleodii MIT1002)
MSANPPLLSQRFRGYFPVVIDVETAGFNAGTDALLELAAVTVKMDENGILHPDQTFHYHI
DPFEGANLEPAALEFNGIDPNCALRGAIEESEAMKDLCKGIRKAQKNADCQRSVIVAHNA
TFDQSFVNAAIERCNIKRTPFHPFVSFDTTSLAGLALGQTVLVKACRAAGIAFDQSEAHS
ALYDAQKTTELFCYMVNRYKALGGWPVENKE