Protein Info for MIT1002_01241 in Alteromonas macleodii MIT1002

Annotation: putative peroxiredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 PF08534: Redoxin" amino acids 5 to 149 (145 residues), 66.8 bits, see alignment E=2.8e-22 PF00578: AhpC-TSA" amino acids 5 to 140 (136 residues), 125.7 bits, see alignment E=1.6e-40 PF10417: 1-cysPrx_C" amino acids 161 to 195 (35 residues), 39.3 bits, see alignment 6.9e-14

Best Hits

Swiss-Prot: 55% identical to AHPC_BUCAP: Alkyl hydroperoxide reductase C (BUsg_176) from Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)

KEGG orthology group: K03386, peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC: 1.11.1.15] (inferred from 98% identity to amc:MADE_02743)

MetaCyc: 52% identical to peroxiredoxin-1 (Homo sapiens)
1.11.1.15-RXN [EC: 1.11.1.24]

Predicted SEED Role

"Alkyl hydroperoxide reductase subunit C-like protein" in subsystem Oxidative stress or Rubrerythrin or Thioredoxin-disulfide reductase

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.15

Use Curated BLAST to search for 1.11.1.15 or 1.11.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (201 amino acids)

>MIT1002_01241 putative peroxiredoxin (Alteromonas macleodii MIT1002)
MSVLVGRPAPDFTAAAVLGSGEIVDTFTLSEAIKGKKAVVFFYPLDFTFVCPSELIAFDK
RFDEFKKRGVEVIGVSIDSQFSHNAWRNTPVNQGGIGPVKYTLVADVKHDICQAYDVEHP
EDGVAFRGSFLIDEEGMVRHQVINDLPLGRNVDEMLRMVDALAFHQEHGEVCPAGWTEGK
AGMDASPEGVAKYLSEEADKL