Protein Info for MIT1002_01228 in Alteromonas macleodii MIT1002

Annotation: 50S ribosomal protein L3 glutamine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 TIGR03533: protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific" amino acids 14 to 299 (286 residues), 423.2 bits, see alignment E=7.1e-131 TIGR00536: methyltransferase, HemK family" amino acids 16 to 306 (291 residues), 290.4 bits, see alignment E=1.9e-90 TIGR03534: protein-(glutamine-N5) methyltransferase, release factor-specific" amino acids 71 to 271 (201 residues), 199.3 bits, see alignment E=1.1e-62 PF05175: MTS" amino acids 137 to 220 (84 residues), 55.4 bits, see alignment E=2e-18 PF13847: Methyltransf_31" amino acids 140 to 266 (127 residues), 36.3 bits, see alignment E=1.7e-12 PF09445: Methyltransf_15" amino acids 140 to 214 (75 residues), 26.8 bits, see alignment E=1.2e-09 PF13649: Methyltransf_25" amino acids 141 to 224 (84 residues), 34.5 bits, see alignment E=9.5e-12

Best Hits

Swiss-Prot: 56% identical to PRMB_SHEON: 50S ribosomal protein L3 glutamine methyltransferase (prmB) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K07320, putative adenine-specific DNA-methyltransferase [EC: 2.1.1.72] (inferred from 95% identity to amc:MADE_02756)

MetaCyc: 56% identical to ribosomal protein L3 N5-glutamine methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-1241 [EC: 2.1.1.298]

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmB, methylates LSU ribosomal protein L3p"

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.72

Use Curated BLAST to search for 2.1.1.298 or 2.1.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>MIT1002_01228 50S ribosomal protein L3 glutamine methyltransferase (Alteromonas macleodii MIT1002)
MTDKFYLEEAIEDLHTLLDMTRWATSRFNDAALYFGHGTDNAWDEATSLVMQALHLPHPI
LEQVGDSVMTSRLTKSEREKIAELVLKRVQTRMPLPYITNEAWFCGMPFYVDERVLIPRS
PFAELIQKEFAPFVESTPNSILDMCTGGACIAIALAHAYPEAQVDAVDISTDALEVADIN
IQEHGLSHRVYPIQSDLFSSLEGQKYDLIVSNPPYVDAEDMADLPEEYHHEPELALAAGE
DGLELVDIMLKEAPTYLNDGGWLFVEVGNSEVHMSERFPGLEVIWLEFENGGSGIFAIRK
NTLVQYFSSKD