Protein Info for MIT1002_01204 in Alteromonas macleodii MIT1002

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 51 to 70 (20 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 182 to 206 (25 residues), see Phobius details amino acids 217 to 239 (23 residues), see Phobius details amino acids 260 to 278 (19 residues), see Phobius details PF04224: DUF417" amino acids 142 to 269 (128 residues), 66.5 bits, see alignment E=1.2e-22

Best Hits

KEGG orthology group: None (inferred from 96% identity to amc:MADE_02777)

Predicted SEED Role

"protein of unknown function DUF417"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>MIT1002_01204 putative membrane protein (Alteromonas macleodii MIT1002)
MTLNQTENMVTALLTFSFAVLGLTFLLGANPNALIATFNFYSLDTVLSESALGAFSGIAL
LLLPLMTIAARFSLVSAKAVTIYAAFVTAVPLLTLLSPTRWMADLGGFPIIGSGQGIIKY
FAVLPLFLFLFYREKFSHRQLTYLNFAPVAMVLLWIGGMKFFEFEANAIVGLVETSPFMS
WLYAVFSVQGASNVIGGFDVLFALLLGAGIFSKNKPVIIASGLACLSVFLMTQTFLFTVP
DTFNSTTIVNRLGQFVIKDLWFVANLAVVAYFTLFEAVSREREEAQLGQSPQ