Protein Info for MIT1002_01197 in Alteromonas macleodii MIT1002

Annotation: Quinoprotein ethanol dehydrogenase precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 616 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR03075: PQQ-dependent dehydrogenase, methanol/ethanol family" amino acids 29 to 577 (549 residues), 739.3 bits, see alignment E=1.2e-226 PF13360: PQQ_2" amino acids 89 to 244 (156 residues), 50.9 bits, see alignment E=2.7e-17 amino acids 491 to 558 (68 residues), 28.3 bits, see alignment E=2e-10 PF13570: PQQ_3" amino acids 115 to 161 (47 residues), 18.1 bits, see alignment 4.4e-07 amino acids 501 to 541 (41 residues), 23.1 bits, see alignment 1.2e-08 PF01011: PQQ" amino acids 523 to 556 (34 residues), 36.1 bits, see alignment (E = 5.3e-13)

Best Hits

Swiss-Prot: 75% identical to EXAA_PSEAE: Quinoprotein alcohol dehydrogenase (cytochrome c) (exaA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00114, alcohol dehydrogenase (cytochrome c) [EC: 1.1.2.8] (inferred from 75% identity to pae:PA1982)

MetaCyc: 75% identical to alcohol dehydrogenase (cytochrome c550) monomer (Pseudomonas aeruginosa)
RXN-11333 [EC: 1.1.2.8]

Predicted SEED Role

"quinoprotein alcohol dehydrogenase" in subsystem Respiratory dehydrogenases 1

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (616 amino acids)

>MIT1002_01197 Quinoprotein ethanol dehydrogenase precursor (Alteromonas macleodii MIT1002)
MAKFYSKASLALSVIIGLGTSSHLYADDGVTWADIENDAKTPENVLMYGMGPEAQRYSGL
DQINKENVHMLSPAWVMSFGDEKQRGQESQAIVYDGIVYVTGSYSRIYAYEAKTGKKLWD
YAHRLPEGIRPCCDVVNRGAAIYGDLVFFGTLDAGVVALDRLTGKVKWKKRFEDYRAGYT
MTGAPTIVKDQKSGKVMLIHGSSGDEFGVVGKLFARDPETGEEIWMRPFVEGHMGRLNGK
DSTPTGGSYEVTTWPKDENGEMVEAWHHGGGAPWQSASFDVETNTIIIGAGNPAPWNTWK
RTAKGGDPRDWDNLYTSGQVGVDATTGEVKWFYQHTPNDAWDFSGNNELVLFDYYDNGKL
IKATAHADRNGFFYVVNRQNGEFIRGFPFVDNITWATHIDPDTGRPVEVDGQRPPLPEPG
EKRGKSIEVSPPFLGGKNWNPMAYSQNTGWFYMGANHWKEDYWTEEVTYKKGAAYLGQGF
RIKRMYDDHVGVLRAVDPISGEIKWTHKEKLPMWAGVLATKGGLIITGTGDGYVKAFDEE
TGEELWKFQTGSGIISCPITWEEDGEQYIGLASGYGGAVPLWGGDMAELTKPVAQGGSFW
VFKLPNHNKKQNVAKQ