Protein Info for MIT1002_01164 in Alteromonas macleodii MIT1002

Annotation: colicin uptake protein TolQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 274 to 295 (22 residues), see Phobius details amino acids 358 to 379 (22 residues), see Phobius details amino acids 399 to 420 (22 residues), see Phobius details PF01618: MotA_ExbB" amino acids 318 to 436 (119 residues), 99.1 bits, see alignment E=8e-33

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 89% identity to alt:ambt_12930)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>MIT1002_01164 colicin uptake protein TolQ (Alteromonas macleodii MIT1002)
MKPVFKSLLAAATVAVAATGAQAQEAKSLKDLLDQVQQNRVSEARLDKQREAEFQSARAD
KQALLRKAQADLKAEQARGDRLQKQFSDNEVTLNEKAAELDQATGTLGEMFGVVRQASSE
AYGRISTSIVSAQFPGRGQFLAEMSEDSKGLPNIKELEDLWFALQKEMTEGGEVVKFTTE
VVNLDGGSSQQEVVRVGTFNLIGEAGYLAYDAEAEVVQPLGRQPDGHFVASADELIGASS
GFVPFFADPSQGAILGLLKQKATMSERYHAGGPVGYTITIMLAIGLLIGIYKMITLTITG
GKMRSQLKNVNNPSEGNPLGRILKVYQENKTADAENLELKLDEAILRELPKIESGINVIK
IFAAIAPLLGLLGTVLGMIETFQTITLFGTGDPRMMAGSISMALVTTAQGIIAALPLILT
HSIVASRSKSIIHILDEQTAGIVAAHSESEKA