Protein Info for MIT1002_01138 in Alteromonas macleodii MIT1002

Annotation: putative D,D-dipeptide transport ATP-binding protein DdpD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 213 to 235 (23 residues), see Phobius details PF00005: ABC_tran" amino acids 23 to 187 (165 residues), 79.8 bits, see alignment E=3e-26 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 238 to 324 (87 residues), 67.9 bits, see alignment E=3.1e-23 PF08352: oligo_HPY" amino acids 239 to 306 (68 residues), 57.4 bits, see alignment E=1.6e-19

Best Hits

Swiss-Prot: 51% identical to SAPD_SALTY: Peptide transport system ATP-binding protein SapD (sapD) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 97% identity to amc:MADE_02838)

MetaCyc: 51% identical to putrescine ABC exporter ATP binding protein SapD (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-328 [EC: 7.6.2.16]

Predicted SEED Role

"Peptide transport system ATP-binding protein SapD (TC 3.A.1.5.5)" in subsystem ABC transporter peptide (TC 3.A.1.5.5) (TC 3.A.1.5.5)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>MIT1002_01138 putative D,D-dipeptide transport ATP-binding protein DdpD (Alteromonas macleodii MIT1002)
MPMLDIKNLTLEMQSSDGAIKALDKVNLSVSSGEIRALVGESGSGKSLIVSAICGALPSQ
WNLTADRMSWNGENLLSMSVQQRREVMRREIAVVFQNPQASLDPSATLGEQLEESIPDEF
VEGSWFWQRAQHRKKIAISTVHKVGIKHHKHYLSAFPHQIPADIGQKFMIAMALVSQPKL
LIADDPTRGMEPTTKTQILKLFTRLNQTRSLSILFVSHDLLAIASMSHSMTVLYAGQTVE
SGRMKHIKKRPLHPYTKALLDSAPSFRKDLPPKSLLPTLGGSIPTLQHLPIGCRLGPRCP
RAQRACVQTPAVRKIHDHNYSCHFPLHMEKL