Protein Info for MIT1002_01135 in Alteromonas macleodii MIT1002

Annotation: Methylmalonyl-CoA carboxyltransferase 5S subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 606 PF00682: HMGL-like" amino acids 7 to 268 (262 residues), 57.1 bits, see alignment E=3.8e-19 TIGR01108: oxaloacetate decarboxylase alpha subunit" amino acids 7 to 601 (595 residues), 857 bits, see alignment E=3.5e-262 PF02436: PYC_OADA" amino acids 292 to 500 (209 residues), 204.7 bits, see alignment E=2.6e-64 PF00364: Biotin_lipoyl" amino acids 540 to 604 (65 residues), 65.8 bits, see alignment E=4.9e-22 PF25917: BSH_RND" amino acids 541 to 602 (62 residues), 27.2 bits, see alignment E=5.9e-10

Best Hits

Swiss-Prot: 60% identical to DCOA_SALTY: Oxaloacetate decarboxylase alpha chain (oadA1) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01571, oxaloacetate decarboxylase, alpha subunit [EC: 4.1.1.3] (inferred from 91% identity to amc:MADE_02841)

Predicted SEED Role

"Oxaloacetate decarboxylase alpha chain (EC 4.1.1.3)" in subsystem Na+ translocating decarboxylases and related biotin-dependent enzymes or Pyruvate metabolism I: anaplerotic reactions, PEP (EC 4.1.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.3

Use Curated BLAST to search for 4.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (606 amino acids)

>MIT1002_01135 Methylmalonyl-CoA carboxyltransferase 5S subunit (Alteromonas macleodii MIT1002)
MSKPLALTELVLRDAHQSLLATRMRIEDMLPIAEKLDKAGFWSVESWGGATFDACIRYLG
EDPWERIRKLKAAMPNTKQQMLLRGQNLLGYRHYADDVVTRFVERAHESGVDVFRIFDAM
NDIRNLKTAIKATIDSGAHAQGTISYTVSPVHNLKLWLEMAKQLEDLGVHSICVKDMAGL
LKPYECEALITGLKETVDVPIAMQCHATTGLSTATYQKAIDAGIDMLDTAISSMSMTYGH
SATETMVSIVEGTERDTGISLPELEDIASYFREVRKKYSKFEGSLKGVDARILLAQVPGG
MLTNMESQLKEQGAEDKFEEVLKEIPRVREDLGFIPLVTPTSQIVGTQSVLNVLTGERYK
SITKETAGVLKGEYGATAAPVNKELQARVLDGAEPVTCRPADNIAPELDTLSKELDELAE
KKQLSLSDDKIDDVLTYALFPQIGLKFIENRGNPDAFEPAPSAQESQSSSAPKPAEAKSS
SQGATASETYDVNVDGRVYRVEVAPSGTLTSVTPASGSQTQAQPQINSAAPSASTASQSI
DAPLAGNVFKVLVRNGDSVSEGDVVMILEAMKMETEIRSAFTGTVTDITVGEGDAVTSGQ
PLILLG