Protein Info for MIT1002_01125 in Alteromonas macleodii MIT1002

Annotation: Neutral endopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 691 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF05649: Peptidase_M13_N" amino acids 59 to 436 (378 residues), 383.2 bits, see alignment E=1.9e-118 PF01431: Peptidase_M13" amino acids 488 to 688 (201 residues), 222 bits, see alignment E=6.5e-70

Best Hits

KEGG orthology group: K07386, putative endopeptidase [EC: 3.4.24.-] (inferred from 95% identity to amc:MADE_02849)

Predicted SEED Role

"Peptidase, M13 family"

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (691 amino acids)

>MIT1002_01125 Neutral endopeptidase (Alteromonas macleodii MIT1002)
MKYKLLAVAIAASLGLAGCGQPEKAQEQTSNVEAPEMKGEAELGSFGVDLTARNEAVKPG
DDFFMYASGTWYDNYELPADKTRYGAFTGLAERSEEQVKNIIDGLMEKSSLNAEEKLVHD
FFVAYMDTDTINEKGIEPIKDVLTSIDSIENKTDLTKAFGNSWLVGSTTPIGGGMWYNRL
DPNEYQLSVGVGGLGLPDRDYYLSDSERFVKIREAYVAHIEQMLNFAGEENAAEKAANIL
ALETQIAEIQWPREKRRDRDLTLNQIERSKLSDEYPGFDWDTYFAQTGYKVPELNITQPE
PVKDVIKIINEADLADWKSYLKYHTISNNADFLSEDIYLANFDFFGRTLSGQQEPRPRWK
RAVSQMSGTESLGFAIGKIYVNEYFPESSKEQMAELVENLRTALGERIENLDWMSEETKV
NAKEKLMAFNPKIGYPDEWQSFDGVTISDKDLVGNVRNLRTFFQDQSVERELEKTDRNRW
GMTPQRVNAYYNSSFNEIVFPAAILQPPFFDPNADAAVNYGAIGAVIGHEMGHGFDDQGS
KSDANGIQRNWWTDADRAAFEEKADMLAEQYSQYEPIEGNFVNGRNSLGENIGDVGGLAM
AYHAYKLSLNGKEAPVIDGLTGDQRFFLAWAQVWKEKRTEESMLNQLRAGTHAPGRYRAQ
APRNHDAWYEAFDVKPGDALYLAPEERVRIW