Protein Info for MIT1002_01105 in Alteromonas macleodii MIT1002

Annotation: chemotaxis regulator CheZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF04344: CheZ" amino acids 43 to 251 (209 residues), 257.7 bits, see alignment E=4.4e-81

Best Hits

Swiss-Prot: 56% identical to CHEZ_SHELP: Protein phosphatase CheZ (cheZ) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K03414, chemotaxis protein CheZ (inferred from 97% identity to amc:MADE_02868)

Predicted SEED Role

"Chemotaxis response - phosphatase CheZ" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>MIT1002_01105 chemotaxis regulator CheZ (Alteromonas macleodii MIT1002)
MSTNVNVPISLEEAKQLVTYLEEGDNASANALLEAASMKENVELFAEVGKLTRQLHDALN
NFQIDDRIKNLATDDIPDAQSRLTYVIEETEKAANTTMDAVEASMPIAEMLSARIEKVMP
EWKKLMNRQIELGEFKALCADLDELLEEGSAQSAKLTQLLTEVLMAQGYQDLTGQVIRRV
IDLVKEVEDSLVNMLTMFGERDGAEQTKPSSVKADKVDGVEAEGPIIDADKRDDVVSGQD
DVDDLLSSLGF