Protein Info for MIT1002_01103 in Alteromonas macleodii MIT1002

Annotation: Sigma-F factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 15 to 235 (221 residues), 112.3 bits, see alignment E=1.8e-36 TIGR02479: RNA polymerase sigma factor, FliA/WhiG family" amino acids 17 to 236 (220 residues), 273.3 bits, see alignment E=1.7e-85 PF04542: Sigma70_r2" amino acids 17 to 90 (74 residues), 66.3 bits, see alignment E=3.4e-22 PF04539: Sigma70_r3" amino acids 99 to 141 (43 residues), 28 bits, see alignment 3.7e-10 PF08281: Sigma70_r4_2" amino acids 180 to 231 (52 residues), 33.6 bits, see alignment E=4.8e-12 PF04545: Sigma70_r4" amino acids 184 to 232 (49 residues), 63.8 bits, see alignment 1.7e-21

Best Hits

KEGG orthology group: K02405, RNA polymerase sigma factor for flagellar operon FliA (inferred from 98% identity to amc:MADE_02870)

Predicted SEED Role

"RNA polymerase sigma factor for flagellar operon" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (243 amino acids)

>MIT1002_01103 Sigma-F factor (Alteromonas macleodii MIT1002)
MNSKAAAYQQQTDKAQLVERHAPLVKRIAHHLIARLPASVLVDDLIQSGMIGLLEAARNF
DGSKGASFETFAGIRIRGAMLDEIRKGDWTPRSVHRNGRAITEAISQVESETGRDARDSD
IADKLNVSLQDYHQMLNEVNAGKLVGIEDLGVSEDVISTEQNRGSDAPLEDLMQGAFQKA
LAHAITTLPEREAIVLSLYYDEELNLREIGEVLDVSESRVSQIHSQAMLKLKSRMKSWQA
DEE