Protein Info for MIT1002_01102 in Alteromonas macleodii MIT1002

Annotation: Flagellum site-determining protein YlxH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 PF13614: AAA_31" amino acids 19 to 176 (158 residues), 61.3 bits, see alignment E=4.3e-20 PF10609: ParA" amino acids 19 to 257 (239 residues), 77 bits, see alignment E=5.7e-25 PF09140: MipZ" amino acids 20 to 197 (178 residues), 35.5 bits, see alignment E=2.5e-12 PF01656: CbiA" amino acids 21 to 235 (215 residues), 59.5 bits, see alignment E=1.2e-19 PF02374: ArsA_ATPase" amino acids 23 to 56 (34 residues), 27.4 bits, see alignment 6.8e-10 PF00142: Fer4_NifH" amino acids 25 to 258 (234 residues), 36.4 bits, see alignment E=1.5e-12

Best Hits

KEGG orthology group: K04562, flagellar biosynthesis protein FlhG (inferred from 100% identity to amc:MADE_02871)

Predicted SEED Role

"Flagellar synthesis regulator FleN" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>MIT1002_01102 Flagellum site-determining protein YlxH (Alteromonas macleodii MIT1002)
MIDDQASSLRKMKQSRLIKVIAVTGGKGGVGKTNITLNTAIAMAKQGKRVMVLDADLGLA
NVDVMLGLRVEKNLSHVLSGECTLDEVLVTGPHGIKIAPATSGTQSMAELSPTQHAGLIR
AFSELRSQIDVLIVDTAAGISDMVLSFSKASQDIMVVVCDEPTSLTDAYALIKILNREHG
VFRFKVVANMVRDVREGQELFSKLSKVTGRFLDVALELVATVPFDENIRKAVRKQTAIVD
AYPGSPAAVAITQLASKALTWPIPAQPGGHLEFFIEQLVAEKAVGSQR