Protein Info for MIT1002_01095 in Alteromonas macleodii MIT1002

Annotation: Flagellar biosynthetic protein FliP precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 46 to 77 (32 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 189 to 215 (27 residues), see Phobius details amino acids 227 to 248 (22 residues), see Phobius details PF00813: FliP" amino acids 50 to 243 (194 residues), 276.5 bits, see alignment E=6.8e-87 TIGR01103: flagellar biosynthetic protein FliP" amino acids 50 to 247 (198 residues), 274.6 bits, see alignment E=2.3e-86

Best Hits

Swiss-Prot: 54% identical to FLIP_SALTY: Flagellar biosynthetic protein FliP (fliP) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02419, flagellar biosynthetic protein FliP (inferred from 98% identity to amc:MADE_02877)

Predicted SEED Role

"Flagellar biosynthesis protein FliP" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>MIT1002_01095 Flagellar biosynthetic protein FliP precursor (Alteromonas macleodii MIT1002)
MRKFAWLLLILPLLLLVEPAYAQQGISAVTVTTNQDGSQDYTMTLQALFIMTALSLIPAF
IMMMTSFTRIIVVLSILRQAIGLQQSPSNQILIGVSLFLSMFIMAPVFEEVNERALQPYL
NEQLTSLDALEQAKGPMRAFMLSQTRVKDLETFVRIAGDEGKYADTNEVPLTILIPAFVT
SELKTAFQIGFMLFIPFLIIDLVVASILMAMGMMMLSPMIVSLPFKLMLFVLVDGWNLIF
GTLATSFGMGV