Protein Info for MIT1002_01082 in Alteromonas macleodii MIT1002

Annotation: Sporulation kinase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 PF13188: PAS_8" amino acids 48 to 102 (55 residues), 28.6 bits, see alignment 2e-10 PF00512: HisKA" amino acids 154 to 218 (65 residues), 51.2 bits, see alignment E=2.1e-17 PF02518: HATPase_c" amino acids 265 to 365 (101 residues), 77.8 bits, see alignment E=1.7e-25

Best Hits

KEGG orthology group: K10942, two-component system, sensor histidine kinase FlrB [EC: 2.7.13.3] (inferred from 91% identity to amc:MADE_02892)

Predicted SEED Role

"Flagellar sensor histidine kinase FleS" in subsystem Flagellum

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (380 amino acids)

>MIT1002_01082 Sporulation kinase A (Alteromonas macleodii MIT1002)
MAFDSTPQSTEYSASSYALDSIDNAISRDEYDPSSSDDISSLRLQASRLEHLLQVMPAGV
IVIDGKGIVRQANEQAKALLGEPLEEEVWRSIITRSFKPRADDGHEVSLVDGRRVKLSIT
PLENEPGQLIVITDLTETRQLQARVSHMQRLSSLGKMVASLAHQIRTPLSAAMLYASNLT
RKGLGQEAQTQFANKLTDRLKELESQVNDMLLFAKSGEEQVVSQISLGELFTSIEGSAQT
MTAQAQQTLTFSGFDKNVSITGNLTALQGALLNLVHNASQVTPKGECVHVETAVSDKRLH
VAIIDKGPGVPDKLKNKIFEPFFTTKTHGTGLGLAVVKSVVNAHNGLLSVSNMPEGGACF
SVSLPCVVNALSSQTLTHVA