Protein Info for MIT1002_01081 in Alteromonas macleodii MIT1002

Annotation: Nitrogen assimilation regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 PF06490: FleQ" amino acids 3 to 108 (106 residues), 79.3 bits, see alignment E=8e-26 PF00158: Sigma54_activat" amino acids 130 to 296 (167 residues), 253.2 bits, see alignment E=3.1e-79 PF14532: Sigma54_activ_2" amino acids 131 to 301 (171 residues), 69.9 bits, see alignment E=8.1e-23 PF07728: AAA_5" amino acids 154 to 273 (120 residues), 31.5 bits, see alignment E=4.8e-11 PF18024: HTH_50" amino acids 434 to 482 (49 residues), 27.6 bits, see alignment 5.6e-10 PF02954: HTH_8" amino acids 439 to 479 (41 residues), 46.6 bits, see alignment 7e-16

Best Hits

KEGG orthology group: K10941, sigma-54 specific transcriptional regulator, flagellar regulatory protein A (inferred from 96% identity to amc:MADE_02894)

Predicted SEED Role

"Flagellar regulatory protein FleQ" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (487 amino acids)

>MIT1002_01081 Nitrogen assimilation regulatory protein (Alteromonas macleodii MIT1002)
MKNILLVSDNQELIQNLETIVTFMGESCQSRGFSDCERYLQDSGADAVLIEHISPAIVSG
LVEKFPHIPFVALVENNSQASAGCNLVSVIATPLTYPVLTQAIHRCQEYSRRKPSLSRTS
GTKTRLFRSLIGKSEQIQIVRRLVEQVAPTDATVLILGESGTGKEVVARNVHFLSERKDG
PFIPVNCGAIPGELLESELFGHEKGAFTGAISARKGRFELAEGGTLFLDEIGDMPLQMQV
KLLRVLQERTFERVGGNKPLQCNVRIIAATHRNLETMISEDKFREDLYYRLNVFPIDSPA
LRQRKVDIPLLLQELNSRIQGDGVEGVRFTEQAIASLMEHEWAGNVRELSNLVERLTILY
PGQIVDIADLPEKYQYGDIQAYEPDYPEEILEREAFNALFAEAAAQEPEEDLNEQSHEGL
NGMVSSSLPEEGVNLKEYLSELEVNLIRQALDNQDWVVARAADKLGMRRTTLVEKMRKYD
IQRTEEA