Protein Info for MIT1002_01054 in Alteromonas macleodii MIT1002

Annotation: A-type flagellin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 PF00669: Flagellin_N" amino acids 5 to 141 (137 residues), 151.8 bits, see alignment E=1.2e-48 PF00700: Flagellin_C" amino acids 239 to 322 (84 residues), 87.9 bits, see alignment E=4.7e-29

Best Hits

KEGG orthology group: K02406, flagellin (inferred from 85% identity to amc:MADE_02916)

Predicted SEED Role

"Flagellin protein FlaA" in subsystem Flagellum or Flagellum in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>MIT1002_01054 A-type flagellin (Alteromonas macleodii MIT1002)
MALTVNTNVSSLNAQRQLMNSGNSLDKAFERLSSGLRINNASDDAAGLQISNRLEGQING
LNQGNRNANDGISVAQTAEGAMEQITDSFQRVRTLAAQAANGSNTDEDRLAIQEEMRALM
EEVNRVAADTTFGGENLLDGTYNGVFQVGSDAVQTIGFSMQNVGGSANTISAAGGFTLSG
IASIASAITGGEALSAKLEGLSDSLGTANLAGDFDFAGVFVASGISVSTQANSQAVLAGM
DSLIAVVDKKRAELGAVQNRFQSTINNQANISENLSAAQSRIRDADFAAETAKLTQNQIL
QQASQAILAQANQRPQAALSLLG