Protein Info for MIT1002_01046 in Alteromonas macleodii MIT1002

Annotation: Distal rod protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 TIGR02488: flagellar basal-body rod protein FlgG" amino acids 4 to 240 (237 residues), 331.4 bits, see alignment E=4.1e-103 TIGR03506: flagellar hook-basal body protein" amino acids 4 to 116 (113 residues), 111.2 bits, see alignment E=8.7e-36 amino acids 127 to 223 (97 residues), 100.3 bits, see alignment E=1.9e-32 PF22692: LlgE_F_G_D1" amino acids 76 to 139 (64 residues), 84.1 bits, see alignment E=6.2e-28 PF06429: Flg_bbr_C" amino acids 196 to 239 (44 residues), 68.2 bits, see alignment 3.4e-23

Best Hits

Swiss-Prot: 56% identical to FLGG_SALTY: Flagellar basal-body rod protein FlgG (flgG) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02392, flagellar basal-body rod protein FlgG (inferred from 100% identity to amc:MADE_02923)

Predicted SEED Role

"Flagellar basal-body rod protein FlgG" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>MIT1002_01046 Distal rod protein (Alteromonas macleodii MIT1002)
MIINLANASTVGFKKDRAVFEDLLYQNINQPGGRSSADTELPSGLMLGSGSKVVATQKAH
TQGNLLTTENALDMSIQGRGYFEILQPDGTIAYSRNGQFSLNDQGQIVTSGAGFLLQPEV
AIPEDAQQITISQDGEISVSIRGQAEPQVLGQLNISDFVNPTGLQPTGQNLYVETASSGA
PIQGIPGLQGLGYISQGTLETSNVNVTEELVNLIESQRLYEMNSKVISSVDQMLGQVIQQ
L