Protein Info for MIT1002_01024 in Alteromonas macleodii MIT1002

Annotation: tRNA-specific adenosine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 PF00383: dCMP_cyt_deam_1" amino acids 41 to 140 (100 residues), 97.1 bits, see alignment E=5.1e-32 PF14437: MafB19-deam" amino acids 44 to 188 (145 residues), 100 bits, see alignment E=1.1e-32

Best Hits

KEGG orthology group: K11991, tRNA-specific adenosine deaminase [EC: 3.5.4.-] (inferred from 59% identity to etr:ETAE_0772)

Predicted SEED Role

"tRNA-specific adenosine-34 deaminase (EC 3.5.4.-)" in subsystem tRNA processing (EC 3.5.4.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.-

Use Curated BLAST to search for 3.5.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (207 amino acids)

>MIT1002_01024 tRNA-specific adenosine deaminase (Alteromonas macleodii MIT1002)
MSDQNSNRPTPNFDLANKQTQEKEAVQEPLTEIAMEDIATEEDIMWMRHALTLADKAESI
GEVPVGACVVLNGELIGEGFNTPITDNDPSAHAELRAVKEAAAAVQNYRLIDATLYVTLE
PCSMCAGMLVHARVKRVVFGAKDAKTGAAGSVMNLLQHPALNHQLEVVSGVLADECANKL
SDFFRKRRKEIKAAKKAKRLLEGDASN