Protein Info for MIT1002_00993 in Alteromonas macleodii MIT1002

Annotation: Glucose-1-phosphate adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 TIGR02091: glucose-1-phosphate adenylyltransferase" amino acids 15 to 387 (373 residues), 444 bits, see alignment E=2e-137 PF00483: NTP_transferase" amino acids 17 to 282 (266 residues), 178.4 bits, see alignment E=1.9e-56 PF24894: Hexapep_GlmU" amino acids 305 to 407 (103 residues), 76.2 bits, see alignment E=2e-25

Best Hits

Swiss-Prot: 48% identical to GLGC2_PSEA6: Glucose-1-phosphate adenylyltransferase 2 (glgC2) from Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

KEGG orthology group: K00975, glucose-1-phosphate adenylyltransferase [EC: 2.7.7.27] (inferred from 71% identity to pat:Patl_3581)

Predicted SEED Role

"Glucose-1-phosphate adenylyltransferase (EC 2.7.7.27)" in subsystem Glycogen metabolism (EC 2.7.7.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.27

Use Curated BLAST to search for 2.7.7.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (457 amino acids)

>MIT1002_00993 Glucose-1-phosphate adenylyltransferase (Alteromonas macleodii MIT1002)
MNAETDIYQIMKDTLVLVLAGGQGSRLKELTKMRAKPVLEFGSHCRIIDFPLSNCVNSGL
KQIAVLTQYKSQCLIRHLMQHWSPLNNSFGGRLDILAASQQRSESWYQGTADACYQNMGY
IKSVVPKYVLILSGDHVYNMDYRKLLTTHVKSNAEMTVSCIEVPTELAANQLGVLKVDCN
SQITAFDEKPRVPHALVDAPDYCLASMGNYVVNADVLFKLLTEDAGSLNSEHDFGKDVIP
SIIAQHRVFAHRFRSPNGAQIPYWRDVGTLDSYWQAHMDLLNNSSLLNLSDPTWPIWGSS
FSRAPTEITNGSHSTCCELKQVLVGSGCKLNSCSVSQSVLSSNVSIGTGSIIDKSVLLPE
VNVGSEARLANVIVDKGVNIPPNFVIADTAIAKQQGFTVTREGVILVTQKVIDRINGSLA
DIDNIQRFMKSSYTGPLSARIVTPKSHEFRDYVLSER