Protein Info for MIT1002_00988 in Alteromonas macleodii MIT1002

Annotation: NADPH-dependent 7-cyano-7-deazaguanine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 TIGR03138: queuine synthase" amino acids 16 to 286 (271 residues), 408.8 bits, see alignment E=1.2e-126 PF14819: QueF_N" amino acids 26 to 136 (111 residues), 157 bits, see alignment E=2.1e-50 PF14489: QueF" amino acids 200 to 275 (76 residues), 81.1 bits, see alignment E=5.5e-27

Best Hits

Swiss-Prot: 60% identical to QUEF_ALIFM: NADPH-dependent 7-cyano-7-deazaguanine reductase (queF) from Aliivibrio fischeri (strain MJ11)

KEGG orthology group: K06879, 7-cyano-7-deazaguanine reductase [EC: 1.7.1.13] (inferred from 88% identity to amc:MADE_03045)

MetaCyc: 57% identical to 7-cyano-7-deazaguanine reductase (Escherichia coli K-12 substr. MG1655)
PreQ(1) synthase. [EC: 1.7.1.13]

Predicted SEED Role

"NADPH dependent preQ0 reductase (EC 1.7.1.13)" (EC 1.7.1.13)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.7.1.13

Use Curated BLAST to search for 1.7.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>MIT1002_00988 NADPH-dependent 7-cyano-7-deazaguanine reductase (Alteromonas macleodii MIT1002)
MSTDNSPQKITITAPDDLSLGKQVDYEFEYNPGLLQGVPRSLSRDTLDLANSSLPFDGID
TWTGYELSWLNLKGKPNVAILECHVPITSENLIESKSFKLYLNSFNQTKFASAEDVRQVL
QADLSACAGETVEVKLILPEQFTSLQFKEFEGTLLDSLDVEIEQYSPNTQFLALAKSGAE
VKETLISHLLKSNCLITSQPDWASIQIRYEGKAIEHEGLLKYLISFRQHNEFHEQCVERI
YNDIMQHCQPDKLTVCARYTRRGGLDINPFRSNYEAPYANHRQARQ